DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP26C1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_899230.2 Gene:CYP26C1 / 340665 HGNCID:20577 Length:522 Species:Homo sapiens


Alignment Length:486 Identity:104/486 - (21%)
Similarity:179/486 - (36%) Gaps:150/486 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNE-----GVWP----FRPGSDIL--------R 129
            |:.||. :|...::||. ::.....::...:...|     ..||    ...||..|        |
Human    77 RERYGT-VFKTHLLGRP-VIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEPHR 139

  Fly   130 YHRTVYRKDF--------FDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFV 186
            ..|.|..:.|        ...:||.:..:.:||   .:...||.:...:..|.|:..:::     
Human   140 RRRKVLARVFSRAALERYVPRLQGALRHEVRSW---CAAGGPVSVYDASKALTFRMAARI----- 196

  Fly   187 ELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHS 251
                                                 .|||..:..:.:...:.|:.|.|     
Human   197 -------------------------------------LLGLRLDEAQCATLARTFEQLVE----- 219

  Fly   252 ADLEMKPSLWRYFKTPL------LKKMLRTMDSVQEVTLKYVDEAI-ERL--EKEAKEG-----V 302
                      ..|..||      |:|.:|..|.:.    ::::.|| |:|  :|.|:.|     :
Human   220 ----------NLFSLPLDVPFSGLRKGIRARDQLH----RHLEGAISEKLHEDKAAEPGDALDLI 270

  Fly   303 VRPE----HEQSVLEKLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEV 363
            :...    ||.|:.|  ||..       |:::|.|...||:|..|:|:|.|.::|...|::|||:
Human   271 IHSARELGHEPSMQE--LKES-------AVELLFAAFFTTASASTSLVLLLLQHPAAIAKIREEL 326

  Fly   364 MK--------VLPNK-------------DSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLT 407
            :.        ..|..             :.:.:.|::..:.|:...:||..|:.|.|.|..|...
Human   327 VAQGLGRACGCAPGAAGGSEGPPPDCGCEPDLSLAALGRLRYVDCVVKEVLRLLPPVSGGYRTAL 391

  Fly   408 RDSVISGYRVPAGTIVSMIPINSLY--SEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPF 470
            |...:.||::|.|..| |..|...:  :..|...|..|.|||:.....||.|        ..:.|
Human   392 RTFELDGYQIPKGWSV-MYSIRDTHETAAVYRSPPEGFDPERFGAAREDSRG--------ASSRF 447

  Fly   471 VFLPFGFGPRMCVGKRIVEMELELGTARLIR 501
            .::|||.|.|.|:|:.:.:..|:|....|:|
Human   448 HYIPFGGGARSCLGQELAQAVLQLLAVELVR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 104/486 (21%)
CYP26C1NP_899230.2 p450 40..504 CDD:299894 104/486 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.