DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP27C1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001354431.1 Gene:CYP27C1 / 339761 HGNCID:33480 Length:537 Species:Homo sapiens


Alignment Length:535 Identity:144/535 - (26%)
Similarity:243/535 - (45%) Gaps:102/535 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PEWLQAKPFEEIPK--ANILSLFAKSALPGGKYKNLEMMEMIDALRQDYGNII-------FLPGM 94
            |..|.|.|.   |:  ||:...|.:....       .:.|:.....::||.|.       |:..:
Human    63 PRSLAAMPG---PRTLANLAEFFCRDGFS-------RIHEIQQKHTREYGKIFKSHFGPQFVVSI 117

  Fly    95 MGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRS 159
            ..||.:..         |.|.||..|.|...:..|.:|     |......|:|.::|:.|...||
Human   118 ADRDMVAQ---------VLRAEGAAPQRANMESWREYR-----DLRGRATGLISAEGEQWLKMRS 168

  Fly   160 IVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETIN----RWTLESVSVVA 220
            ::...:::||:|.:|   ..:|||...:|||.|....:|...|..:..:|    ::::|.|:.:.
Human   169 VLRQRILKPKDVAIY---SGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATIL 230

  Fly   221 LDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKPSLWRYFKT------------PLLKK-- 271
            .:.:||.|    :||......:|::.       ||:   ::..|||            |.:.|  
Human   231 YESRLGCL----ENSIPQLTVEYIEA-------LEL---MFSMFKTSMYAGAIPRWLRPFIPKPW 281

  Fly   272 --MLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSV---------LEKLLKVDKKVATV 325
              ..|:.|.:.:.:..:||..:..::.:...|       :.|         |.:.|.:.:..|.|
Human   282 REFCRSWDGLFKFSQIHVDNKLRDIQYQMDRG-------RRVSGGLLTYLFLSQALTLQEIYANV 339

  Fly   326 MAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIK 390
              .:||:|||||||.|.:..:..||::||.|..:..|::|.|..:... |.|.:..||.:||.:|
Human   340 --TEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVP-TAADVPKVPLVRALLK 401

  Fly   391 ESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLRNASDS 455
            |:.|::|::.||.|....|.||.||.:|.||.:::....:.|.:|.||:..||.||||||.    
Human   402 ETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRK---- 462

  Fly   456 AGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALI 520
                  .||...:.|..:|||.|.|.|:|:||.|:|:.|...:|:::|.::.:..| ||..:...
Human   463 ------GDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQT-NAVHAKTH 520

  Fly   521 NL--PNIPLKFKFTD 533
            .|  |..|:..:|.:
Human   521 GLLTPGGPIHVRFVN 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 134/487 (28%)
CYP27C1NP_001354431.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3768
Isobase 1 0.950 - 0 Normalized mean entropy S4770
OMA 1 1.010 - - QHG48087
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 1 0.900 - - OOG6_100895
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.