DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp26c1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_217935.3 Gene:Cyp26c1 / 308190 RGDID:1308843 Length:518 Species:Rattus norvegicus


Alignment Length:532 Identity:114/532 - (21%)
Similarity:204/532 - (38%) Gaps:128/532 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVFSASQQRWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFAKSAL----PGGKYKNLEMMEM 77
            ::...:||.|     |.......:|....|   :||.::...|....|    .|.::.:      
  Rat    24 LLLGLAQQLW-----TLRWTLSRDWASTLP---LPKGSMGWPFFGETLHWLVQGSRFHS------ 74

  Fly    78 IDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRK----- 137
              :.|:.||. :|...::||.             |.|..|....|  :.:|..||.|..:     
  Rat    75 --SRRERYGT-VFKTHLLGRP-------------VIRVSGAENVR--TILLGEHRLVRSQWPQSA 121

  Fly   138 DFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFV-----ELIKEIRDAST 197
            ....|...::.:.|:.....|.::..|..:|            ..::||     .|.:|:|....
  Rat   122 HILLGSHTLLGAVGERHRQRRKVLARVFSRP------------ALEQFVPRLQEALRREVRSWCA 174

  Fly   198 QEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKPSLWR 262
            .:.|....:.....|....:.:.    |||..:..:.:|..:.|:.|.|               .
  Rat   175 AQRPVAVYQAAKALTFRMAARIL----LGLQLDEARCTELAQTFERLVE---------------N 220

  Fly   263 YFKTPL------LKKMLRTMDSVQEVTLKYVDEAI-ERLEKE--AKEG-----VVRPEHEQSVLE 313
            .|..||      |:|.:|..|.:.:    ::||.| |:|.:|  |:.|     ::....|   |.
  Rat   221 LFSLPLDVPFSGLRKGIRARDQLYQ----HLDEVIAEKLREELTAEPGDALHLIINSARE---LG 278

  Fly   314 KLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEV--------MKVLPNK 370
            :.|.|.:  ...:|:::|.|...||:|..|:|:|.|.::|...|::::|:        ....|..
  Rat   279 RELSVQE--LKELAVELLFAAFFTTASASTSLILLLLQHPAAIAKIQQELSAQGLGSPCSCAPRA 341

  Fly   371 ---------DSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMI 426
                     :.:.:.|.:..:.|:...:||..|:.|.|.|..|...|...:.||::|.|..| |.
  Rat   342 SGSRPDCSCEPDLSLAVLGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSV-MY 405

  Fly   427 PINSLY--SEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVE 489
            .|...:  :..|...|..|.|||:...:.|:.|        :...|.::|||.|.|.|:|:.:.:
  Rat   406 SIRDTHETAAVYRSPPEGFDPERFGVESEDARG--------SGGRFHYIPFGGGARSCLGQELAQ 462

  Fly   490 MELELGTARLIR 501
            ..|:|....|:|
  Rat   463 AVLQLLAVELVR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 103/464 (22%)
Cyp26c1XP_217935.3 p450 40..500 CDD:299894 110/511 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.