DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP24A1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000773.2 Gene:CYP24A1 / 1591 HGNCID:2602 Length:514 Species:Homo sapiens


Alignment Length:459 Identity:126/459 - (27%)
Similarity:219/459 - (47%) Gaps:54/459 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPS 149
            ||.|..:  .:|....|...:|...|.::|.|..:|.|......:.:|. |||:.:    |::..
Human    93 YGKIFRM--KLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRD-YRKEGY----GLLIL 150

  Fly   150 QGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETINRWTLE 214
            :|:.|...||.....||:|..|.....|:::|..:|:..|.|:.| ....|...:.| :|:|:.|
Human   151 EGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCD-ERGHVEDLYSE-LNKWSFE 213

  Fly   215 SVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKPSLWRYFKTPL-LKKMLRT--- 275
            |:.:|..:|:.|||:::. ..||....         .|...|..:..|...||: |.|.|.|   
Human   214 SICLVLYEKRFGLLQKNA-GDEAVNFI---------MAIKTMMSTFGRMMVTPVELHKSLNTKVW 268

  Fly   276 ------MDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKVDKKVATVMAMDMLMAG 334
                  .|::.:.....:|..:|:..::.....:...:.|:      ::.||.......::.:|.
Human   269 QDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQN------RLSKKELYAAVTELQLAA 327

  Fly   335 VDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLV 399
            |:||:::...:|..|::||:.|.:|.:|:..|||.......| .::|:|||:||:|||.|:.|.|
Human   328 VETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAE-DLRNMPYLKACLKESMRLTPSV 391

  Fly   400 IGNARGLTRDSVISGYRVPAGTIVSMIPINSL-YSEEYFPKPTEFLPERWLRNASDSAGKCPAND 463
            ....|.|.:.:|:..|.:|.||:: |:....| .||:.|...::|.|||||:.            
Human   392 PFTTRTLDKATVLGEYALPKGTVL-MLNTQVLGSSEDNFEDSSQFRPERWLQE------------ 443

  Fly   464 LKTK-NPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEF--NHSTKNAFRSALINLPNI 525
             |.| |||..||||.|.|||:|:|:.|::|.|....::|.::::.  |...:......|:....:
Human   444 -KEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSREL 507

  Fly   526 PLKF 529
            |:.|
Human   508 PIAF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 126/459 (27%)
CYP24A1NP_000773.2 p450 59..512 CDD:278495 126/459 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3768
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 1 1.000 - - FOG0000720
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 1 0.900 - - OOG6_100895
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.