DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp11b2

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus


Alignment Length:529 Identity:135/529 - (25%)
Similarity:232/529 - (43%) Gaps:100/529 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PEWLQAKPFEEIPKANILSLFAKSALPGGKYKNLEMMEMIDALRQDYGNIIFLP----------- 92
            |:.||  |||.||                :|...:.::||..||:.....:.|.           
Mouse    32 PKTLQ--PFEAIP----------------QYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPI 78

  Fly    93 --GMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGV-QGIIPSQGKSW 154
              ..:|:..:|....|:|.|.:.:.|.:.|.|...:....||.:      .|: :|:....|..|
Mouse    79 FRHSVGKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHREL------RGLRRGVFLLNGPEW 137

  Fly   155 GDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKE-----IRDASTQEVPGNFLETINRWTLE 214
            ...|..:|..::.||.|:.:...:..|.::|:|.:||     .|.:.|.:|.    :::..:|:|
Mouse   138 RLNRLRLNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTMDVQ----QSLFNYTIE 198

  Fly   215 SVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKP-SLWRYFKTPLLKKMLRTMDS 278
            :.:.....::||||... .:..:.|....|...|..::.|...| ||.|:..|.:.|:.....|.
Mouse   199 ASNFALFGERLGLLGHD-LSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDV 262

  Fly   279 VQEVTLKYVDEAIERLEKEAK-------EGVVRPEHEQSVLEKLLKVDKKVATVMAMDMLMAGVD 336
            :.|    |.:..|.::.:|.:       .|:|    .:.:.:..|.:|...|.  :|::....||
Mouse   263 ISE----YANRCIWKVHQELRLGSSQTYSGIV----AELISQGSLPLDAIKAN--SMELTAGSVD 317

  Fly   337 TTSSTFTALLLCLAKNPEKQARLREEVM----KVLPNKDSEFTEASMKNVPYLRACIKESQRVYP 397
            ||:......|..||:||:.|..||:|.:    .:..|     .:.:|.::|.|||.:||:.|:||
Mouse   318 TTAIPLVMTLFELARNPDVQKALRQESLAAEASIAAN-----PQKAMSDLPLLRAALKETLRLYP 377

  Fly   398 LVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYS----EEYFPKPTEFLPERWLRNASDSAGK 458
            :.....|.|:.|.|:..|.|||||:|.:.    |||    ...||:|..::|:||          
Mouse   378 VGGFLERILSSDLVLQNYHVPAGTLVLLY----LYSMGRNPAVFPRPERYMPQRW---------- 428

  Fly   459 CPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEF--NHSTKNAFRSALIN 521
                 |:.|..|..|.||||.|.|:|:|:.|:|:.|....:::.|.||.  ....:.|:|..|:.
Mouse   429 -----LERKRSFQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMP 488

  Fly   522 LPNIPLKFK 530
            ..:..|.|:
Mouse   489 SSSPVLTFR 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 124/487 (25%)
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 127/514 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8705
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.