DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynD and ATPQ

DIOPT Version :9

Sequence 1:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_190798.1 Gene:ATPQ / 824395 AraportID:AT3G52300 Length:168 Species:Arabidopsis thaliana


Alignment Length:145 Identity:34/145 - (23%)
Similarity:70/145 - (48%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQSSINWSALAE--------RVPANQKSSFGAFKTKSDIYVRAVLANPECPPQIDWANYKKLVPV 63
            |..:|:|..:|:        |..:|.:.:|....|:.....      .:.|..|||..|:|.:. 
plant    15 ASRTIDWDGMAKVLVTDEARREFSNLRRAFDEVNTQLQTKF------SQEPEPIDWDYYRKGIG- 72

  Fly    64 AGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSEIDAYKKASEQRIQNYQKEIAHLKSL-LP 127
            ||:||.:::.|:::::|...|||:.:...:..|...|:...::.|.:..:..:||||.::.: ..
plant    73 AGIVDKYKEAYDSIEIPKYVDKVTPEYKPKFDALLVELKEAEQKSLKESERLEKEIADVQEISKK 137

  Fly   128 YDQMTMEDYRDAFPD 142
            ...||.::|.:..|:
plant   138 LSTMTADEYFEKHPE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 33/141 (23%)
ATPQNP_190798.1 Mt_ATP-synt_D 14..154 CDD:399107 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4440
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102981
Panther 1 1.100 - - LDO PTHR12700
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.