DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynD and Atp5pd

DIOPT Version :9

Sequence 1:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_062256.1 Gene:Atp5pd / 641434 RGDID:620083 Length:161 Species:Rattus norvegicus


Alignment Length:162 Identity:61/162 - (37%)
Similarity:100/162 - (61%) Gaps:1/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPPQIDWANYKKLVPVAG 65
            ||.|::|..:|:|.:..|.:|.|||:...|.|:.::.:...:.:..|.||.||||.|:..|...|
  Rat     1 MAGRKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRANVDKPG 65

  Fly    66 LVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSEIDAYKKASEQRIQNYQKEIAHLKSLLPYDQ 130
            |||.|:.:|.|||:|.|:||.::.||||.|........:...|:.|::.|:|::..:|:::|:||
  Rat    66 LVDDFKNKYNALKIPVPEDKYTALVDAEEKEDVKNCAQFVTGSQARVREYEKQLEKIKNMIPFDQ 130

  Fly   131 MTMEDYRDAFPDSALDPLNKPTFWPHTPEEQV 162
            ||::|..:.||::.||....| :|||.|.|.:
  Rat   131 MTIDDLNEVFPETKLDKRKYP-YWPHQPIENL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 56/148 (38%)
Atp5pdNP_062256.1 Mt_ATP-synt_D 3..155 CDD:399107 55/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352970
Domainoid 1 1.000 125 1.000 Domainoid score I5361
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130552
Inparanoid 1 1.050 132 1.000 Inparanoid score I4526
OMA 1 1.010 - - QHG47984
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 1 1.000 - - oto96800
orthoMCL 1 0.900 - - OOG6_102981
Panther 1 1.100 - - LDO PTHR12700
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6072
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.