DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynD and LOC500350

DIOPT Version :9

Sequence 1:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001041422.1 Gene:LOC500350 / 500350 RGDID:1560316 Length:409 Species:Rattus norvegicus


Alignment Length:89 Identity:31/89 - (34%)
Similarity:51/89 - (57%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSEIDAYKKASEQRIQNYQKEIAHL 122
            |..|..|||.|..:||:.|.|:|.|:||.::.||.|  ...:....:...|:.|||..:|::..:
  Rat   228 KASVAKAGLADDCEKQFNAPKIPVPEDKHTALVDEE--KDVNNCAEFLSGSQARIQKNEKQLEKM 290

  Fly   123 KSLLPYDQMTMEDYRDAFPDSALD 146
            |:::|.|||..:   :.||::.||
  Rat   291 KNIIPSDQMITD---EIFPETKLD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 31/89 (35%)
LOC500350NP_001041422.1 Mt_ATP-synt_D <228..314 CDD:283519 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102981
Panther 1 1.100 - - O PTHR12700
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.