DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynD and atp7

DIOPT Version :9

Sequence 1:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596058.1 Gene:atp7 / 2540446 PomBaseID:SPBC29A10.13 Length:175 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:33/148 - (22%)
Similarity:72/148 - (48%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQSSINWSALAE--RVPANQKSSFGAFKTKSDIYVRAVLANPECPPQIDWANYKKLV---PVAGL 66
            |..:|:|:::|.  ::.|...|:...|:::....|..:....|....:|:|.|:.::   .:...
pombe     8 AGKAIDWASVASKLKLDAATASAIANFRSRHAQAVAKLGTLREQATTVDFATYRSVLANKEIVNR 72

  Fly    67 VDSFQKQYEALKVPYPQDKVSSQVDA----EIKASQSEIDAYKKASE---QRIQNYQKEIAHLKS 124
            ::|..|.::.:|:     .::||:.|    |.|||:..    ||..|   ..:||....:.:::.
pombe    73 IESSMKSFKPVKI-----DLNSQLKAINAFEAKASEGA----KKNVELVKAELQNLSATLKNIEQ 128

  Fly   125 LLPYDQMTMEDYRDAFPD 142
            ..|.:::|:||.:.|.|:
pombe   129 ARPTEEITIEDMKQAVPE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 32/144 (22%)
atp7NP_596058.1 Mt_ATP-synt_D 12..147 CDD:283519 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102981
Panther 1 1.100 - - LDO PTHR12700
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2043
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.