DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynD and atp-5

DIOPT Version :9

Sequence 1:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_505829.1 Gene:atp-5 / 179541 WormBaseID:WBGene00007385 Length:191 Species:Caenorhabditis elegans


Alignment Length:191 Identity:58/191 - (30%)
Similarity:91/191 - (47%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPPQIDWANYKKLVPV-AG 65
            ||:|:|.||:|||.||||:.....:.....|..|..:..||...|...|:||:|..||.:|. :.
 Worm     4 AAKRVATSSVNWSKLAERLVPEHAAELTRVKGVSGTFQSAVSQLPADLPKIDFAALKKALPAHSA 68

  Fly    66 LVDSFQKQYEALKVPYPQ------DKVSSQVD---AEIKASQSEI----DAYKKASEQ-----RI 112
            ::||.|||||::|:||.:      .:|...||   |.||..:.::    ...||..|:     .:
 Worm    69 VLDSLQKQYESVKIPYGEVPAEYLKEVDQWVDYNNARIKLHEVKVADGLQEAKKVEEKWAKAPPV 133

  Fly   113 QNYQKEIAHLKSLLP---YDQMTMEDYRDAFPDSALDPLNKPTFWPHTPEEQVGYKSKEQL 170
            :::.::  |.....|   ||..    |::..||.....||:      |||.:..:|..:.|
 Worm   134 EHFDRQ--HFVEYFPAHFYDLR----YQNRIPDPCNIGLNE------TPEIENRFKDYKVL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 49/170 (29%)
atp-5NP_505829.1 Mt_ATP-synt_D 13..155 CDD:283519 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166508
Domainoid 1 1.000 67 1.000 Domainoid score I6423
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3936
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47984
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 1 1.000 - - oto17744
orthoMCL 1 0.900 - - OOG6_102981
Panther 1 1.100 - - LDO PTHR12700
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2043
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.