DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL55 and Mrpl55

DIOPT Version :9

Sequence 1:NP_650780.1 Gene:mRpL55 / 42290 FlyBaseID:FBgn0038678 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001099252.1 Gene:Mrpl55 / 287356 RGDID:1308161 Length:127 Species:Rattus norvegicus


Alignment Length:87 Identity:40/87 - (45%)
Similarity:60/87 - (68%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVTRLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVK 86
            ::|||.|..|.||||.::|:.|||||:|||.|||:::.:||||..|:..|||||...|:.:.:.|
  Rat    38 SLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQK 102

  Fly    87 IMEEVE--DNFNAKKYMKYIKK 106
            ..||.|  |:|:.::|.::..|
  Rat   103 REEEPEMVDSFDTERYKRFWTK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL55NP_650780.1 Mitoc_L55 <17..97 CDD:286817 38/76 (50%)
Mrpl55NP_001099252.1 Mitoc_L55 10..124 CDD:401650 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8269
eggNOG 1 0.900 - - E1_KOG4616
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5110
OMA 1 1.010 - - QHG45876
OrthoDB 1 1.010 - - D1553019at2759
OrthoFinder 1 1.000 - - FOG0007128
OrthoInspector 1 1.000 - - oto95897
orthoMCL 1 0.900 - - OOG6_109198
Panther 1 1.100 - - LDO PTHR34095
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5994
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.