DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL55 and mrpl-55

DIOPT Version :10

Sequence 1:NP_650780.1 Gene:mRpL55 / 42290 FlyBaseID:FBgn0038678 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_499930.2 Gene:mrpl-55 / 176873 WormBaseID:WBGene00022045 Length:125 Species:Caenorhabditis elegans


Alignment Length:111 Identity:35/111 - (31%)
Similarity:58/111 - (52%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLPQAVQQIRCISSATTAVT------------RLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKI 57
            |:...:.....::|.:.|:|            ::.|..|...|....::||||||.:...|||:.
 Worm     4 QMNTQISMRNLLTSCSKAITAERNNAWRASLGKISRRDYLHRYQVKFIRPDGSTIMVPAAEPRQT 68

  Fly    58 IKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKYMKY 103
            .:..:||..|::.|||.||.||||:.|:...|.::|.|:..:|||:
 Worm    69 FQSAVDLKQLSEDERRQRLAARKPKAKITKTEVIDDTFDESEYMKF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL55NP_650780.1 Mitoc_L55 <18..96 CDD:462893 30/89 (34%)
mrpl-55NP_499930.2 Mitoc_L55 6..117 CDD:462893 34/109 (31%)

Return to query results.
Submit another query.