DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL55 and mrpl-55

DIOPT Version :9

Sequence 1:NP_650780.1 Gene:mRpL55 / 42290 FlyBaseID:FBgn0038678 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_499930.2 Gene:mrpl-55 / 176873 WormBaseID:WBGene00022045 Length:125 Species:Caenorhabditis elegans


Alignment Length:111 Identity:35/111 - (31%)
Similarity:58/111 - (52%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLPQAVQQIRCISSATTAVT------------RLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKI 57
            |:...:.....::|.:.|:|            ::.|..|...|....::||||||.:...|||:.
 Worm     4 QMNTQISMRNLLTSCSKAITAERNNAWRASLGKISRRDYLHRYQVKFIRPDGSTIMVPAAEPRQT 68

  Fly    58 IKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKYMKY 103
            .:..:||..|::.|||.||.||||:.|:...|.::|.|:..:|||:
 Worm    69 FQSAVDLKQLSEDERRQRLAARKPKAKITKTEVIDDTFDESEYMKF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL55NP_650780.1 Mitoc_L55 <17..97 CDD:286817 31/91 (34%)
mrpl-55NP_499930.2 Mitoc_L55 5..116 CDD:286817 34/110 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167929
Domainoid 1 1.000 66 1.000 Domainoid score I6554
eggNOG 1 0.900 - - E1_KOG4616
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3953
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45876
OrthoDB 1 1.010 - - D1553019at2759
OrthoFinder 1 1.000 - - FOG0007128
OrthoInspector 1 1.000 - - oto18399
orthoMCL 1 0.900 - - OOG6_109198
Panther 1 1.100 - - LDO PTHR34095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4338
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.