DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL55 and MRPL55

DIOPT Version :9

Sequence 1:NP_650780.1 Gene:mRpL55 / 42290 FlyBaseID:FBgn0038678 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_852127.2 Gene:MRPL55 / 128308 HGNCID:16686 Length:164 Species:Homo sapiens


Alignment Length:90 Identity:39/90 - (43%)
Similarity:64/90 - (71%) Gaps:6/90 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SATTAVTRLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKIIKLPLDLSTLTDAERRARLEAR--- 79
            |:..::||:||..|.||||.::|:.|||||:|||.|||:::.:|:||.||:..||||||..|   
Human    71 SSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQ 135

  Fly    80 -KPRKKVKIMEEVEDNFNAKKYMKY 103
             :.||:.:  :|:.|:.:.::|.::
Human   136 LQSRKEYE--QELSDDLHVERYRQF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL55NP_650780.1 Mitoc_L55 <17..97 CDD:286817 38/82 (46%)
MRPL55NP_852127.2 Mitoc_L55 47..161 CDD:286817 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8325
eggNOG 1 0.900 - - E1_KOG4616
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5187
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45876
OrthoDB 1 1.010 - - D1553019at2759
OrthoFinder 1 1.000 - - FOG0007128
OrthoInspector 1 1.000 - - oto88763
orthoMCL 1 0.900 - - OOG6_109198
Panther 1 1.100 - - LDO PTHR34095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4338
SonicParanoid 1 1.000 - - X5994
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.