DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL55 and mrpl55

DIOPT Version :9

Sequence 1:NP_650780.1 Gene:mRpL55 / 42290 FlyBaseID:FBgn0038678 Length:107 Species:Drosophila melanogaster
Sequence 2:XP_002939355.2 Gene:mrpl55 / 100488793 XenbaseID:XB-GENE-6461298 Length:134 Species:Xenopus tropicalis


Alignment Length:93 Identity:41/93 - (44%)
Similarity:62/93 - (66%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SATTAVTRLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKIIKLPLDLSTLTDAERRARLEARKPR 82
            |..|::.|..|....|.||.::|||||||:.|:|.|||:|:.:|:|:|||::.:|:|||..|...
 Frog    42 SNRTSIVRCGRKTLIRQYPVLLVQPDGSTVTIQYKEPRRILTMPVDISTLSEEDRKARLRKRDQS 106

  Fly    83 KKV---KIMEEVEDNFNAKKYMKYIKKK 107
            |:|   :..||.:|.|:..:|.|:.|||
 Frog   107 KRVTAKQDKEEFDDGFSVDQYSKFWKKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL55NP_650780.1 Mitoc_L55 <17..97 CDD:286817 36/81 (44%)
mrpl55XP_002939355.2 Mitoc_L55 18..133 CDD:370682 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8249
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5007
OMA 1 1.010 - - QHG45876
OrthoDB 1 1.010 - - D1553019at2759
OrthoFinder 1 1.000 - - FOG0007128
OrthoInspector 1 1.000 - - oto102635
Panther 1 1.100 - - LDO PTHR34095
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5994
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.