DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and zgc:162952

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:XP_005171926.1 Gene:zgc:162952 / 555791 ZFINID:ZDB-GENE-070424-98 Length:328 Species:Danio rerio


Alignment Length:302 Identity:142/302 - (47%)
Similarity:194/302 - (64%) Gaps:13/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIGSGFFSEVYKVTHRTTGQVMVLKM 140
            |.:|.....|||........:.|||||..|...::|..|.|||||||:||||.|.||.:|||:|:
Zfish    25 PTSPTLCNESSDTYCHVDRWQKLRTAVRKLEFWENFTHELIGSGFFSKVYKVIHNTTRKVMVVKI 89

  Fly   141 NQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQ 205
            .:...::.:::||:.||.||||.||:.::|:||:|.:|:.:.||::||.||:|||.::|.|...:
Zfish    90 YKNDVDQDSIVREISLLQKLSHPNIVRYLGICVKEDKLYPILEYVSGGCLEELLARQDVPLCWRE 154

  Fly   206 KIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLA---AKIPVKSRKSRL 267
            |:.||..|.|||.|:|...|:||||.|||.|||..|..: ||:|.|||||   .::|.|.||  |
Zfish   155 KVDLASDITRGMIYLHYKNIYHRDLNSKNCLIRMTARGR-EALVTDFGLAREVVELPSKDRK--L 216

  Fly   268 ETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAF---VEL 329
            ..|||.:|::||.|:|:.||:..|||||||:.|||:|||.|||:::|||..:|||..||   |..
Zfish   217 SLVGSAFWMAPEMLRGEPYDRKVDVFSFGIVLCEILARIPADPEILPRTQDYGLDVSAFRKMVSG 281

  Fly   330 CPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYE 371
            ||..    .|.||..|||.||..||:|.:...:|..:.|..|
Zfish   282 CPQR----LLELAASCCLLDAFRRPSFTELQDELGEIAESLE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 127/255 (50%)
PKc_like 116..370 CDD:304357 128/259 (49%)
zgc:162952XP_005171926.1 TyrKc 63..311 CDD:197581 127/254 (50%)
PKc_LIMK_like_unk 65..318 CDD:271058 128/259 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5384
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.