DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and Ilk

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:249 Identity:65/249 - (26%)
Similarity:101/249 - (40%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 MVLKMNQLRANRPNMLR----EVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLAN 196
            :|.|:..:|...|.:.|    |...|...||.|||..:|.|.....|..:::::...||..||..
  Fly   216 VVAKILAVRQCTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHG 280

  Fly   197 KE-VVLSATQKIRLALGIARGMSYVHD----AGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAA 256
            .. ||:..:|.:..||.:||||:::|.    ...:|  |.|.:|:|             |..|.|
  Fly   281 ATGVVVDTSQAVSFALDVARGMAFLHSLERIIPTYH--LNSHHVMI-------------DDDLTA 330

  Fly   257 KIPVKSRKSRLETVG---SPYWVSPECLKGQWYD---QTSDVFSFGIIQCEIIARIEADPDMMPR 315
            :|.:...|...:..|   .|.|:|||.|:.:..|   :..|::||.|:..|:..|.....:..|.
  Fly   331 RINMGDAKFSFQEKGRIYQPAWMSPETLQRKQADRNWEACDMWSFAILIWELTTREVPFAEWSPM 395

  Fly   316 TASFGLDYLAFVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEK 369
            .....:.........|..|.....:|...|...|...||.|    ..:..:|||
  Fly   396 ECGMKIALEGLRVKIPPGTSTHMAKLISICMNEDPGKRPKF----DMVVPILEK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 62/241 (26%)
PKc_like 116..370 CDD:304357 65/249 (26%)
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 65/249 (26%)
STYKc 204..443 CDD:214568 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.