DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and limk2

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_001002651.1 Gene:limk2 / 436924 ZFINID:ZDB-GENE-040718-398 Length:651 Species:Danio rerio


Alignment Length:353 Identity:125/353 - (35%)
Similarity:180/353 - (50%) Gaps:59/353 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DATAEAPVKHQPLHNGGWIGNGLPPAPV----------TRTIS-SDRLVTGSSC--RALRTAVSA 104
            |......:|.:.|..    .|.:..:||          ||.|. |:.|.:.|||  |..|..   
Zfish   278 DTVDNGTLKRRSLRR----SNSICKSPVSSSPKDHLVLTRDIGRSESLRSPSSCSHRIFRPC--- 335

  Fly   105 LYSVDDFVK-EKIGSGFFSEVYKVTHRTTGQVMVLKMNQLRAN---RPNMLREVQLLNKLSHANI 165
                 |.:. |.:|.|||.:..||||:.||:|||:| ..:|.:   :...|:||:::..|.|.::
Zfish   336 -----DLIHGEILGKGFFGQAIKVTHKATGEVMVMK-ELIRCDEETQKTFLKEVKVMRSLDHTHV 394

  Fly   166 LSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDL 230
            |.|:||..::.:|:.:||:|.||:|:..:.:.: .....|::..|..||.||:|:|...|.||||
Zfish   395 LKFIGVLYKDKRLNLITEFIEGGTLKDFIRDTD-SFPWEQRVSFAKSIASGMAYLHSMSIIHRDL 458

  Fly   231 TSKNVLIRNLANDQYEAVVGDFGLAAKI---------PVK-----------SRKSRLETVGSPYW 275
            .|.|.|:: |.|   ..||.||||:..|         |.|           .||.|...||:|||
Zfish   459 NSHNCLVK-LDN---TVVVADFGLSRLIMEDKVKQPPPDKPTNKKRLFRRIDRKKRYTVVGNPYW 519

  Fly   276 VSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAFVE-LCPMDTPPVFL 339
            ::||.|.|:.||:..|:|||||:.||||.::.|||:.:|||..|||:...|:| ..|...||.|.
Zfish   520 MAPEMLNGKRYDEKVDIFSFGIVLCEIIGQVYADPECLPRTLDFGLNVRTFIEKFLPEHCPPAFF 584

  Fly   340 RLAFYCCLYDAKSRPTF---HDATKKLT 364
            .||..||.....:||.|   .|..:.||
Zfish   585 ALAVACCDLTPDNRPAFQKLEDCFEALT 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 106/277 (38%)
PKc_like 116..370 CDD:304357 107/276 (39%)
limk2NP_001002651.1 LIM1_LIMK2 12..64 CDD:188847
LIM2_LIMK2 66..124 CDD:188849
PDZ 152..234 CDD:278991
STYKc 340..608 CDD:214568 106/273 (39%)
STKc_LIMK2 343..615 CDD:271124 107/276 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.