DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and Takl2

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:301 Identity:86/301 - (28%)
Similarity:125/301 - (41%) Gaps:50/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KEKIGSGFFSEVYKVTHRTTGQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQ 177
            ||.||:||:..||:...|  .:.:.||..:.......:.||:..|.|.||.||:...|....||.
  Fly    16 KELIGTGFYGSVYRAVWR--NREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGTSRHEGC 78

  Fly   178 LHALTEYINGGSLEQLL-ANKEVVLSATQKIRLALGIARGMSYVH---DAGIFHRDLTSKNVLIR 238
            ...|.|:::||||...| |..:...|.......|..||:|::|:|   ...:.|||:...|.|  
  Fly    79 ALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTL-- 141

  Fly   239 NLANDQYEAVVGDFGLAAKIPVKSRKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEII 303
             |.....:..:.|||..    |...:|.....|:..:.:||.|:|...|:..||:|:.|...||:
  Fly   142 -LCEKGLKLKICDFGTV----VDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAITFWEIL 201

  Fly   304 ARIEADPDMMPRTASFGLDYLAFVE------LCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKK 362
            :|.|  |.....|. |.| |:|..|      .|.|...|..:....|     |...|   |.:|:
  Fly   202 SRKE--PFEQYNTL-FEL-YMAINEGERPDLSCIMSGCPADIVALLY-----ASWDP---DISKR 254

  Fly   363 LTLLLEKYEHESSAGASPLSSLELINCSPGGSDSENVTLTP 403
            .                   |:|||:.|.|...||..::.|
  Fly   255 F-------------------SMELISQSMGRILSEAGSIPP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 77/259 (30%)
PKc_like 116..370 CDD:304357 75/263 (29%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 78/281 (28%)
PKc_like 19..268 CDD:304357 81/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.