DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and ksr

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster


Alignment Length:506 Identity:109/506 - (21%)
Similarity:164/506 - (32%) Gaps:170/506 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QHSGPGPPSEICGLSVDQVDSSAASPFIWP------STAGMCTTATTVTTSTNGDATAEAPVKHQ 63
            ||.....||..|      ..|:.:||.::.      ..||..::|..:.|.:.|        |||
  Fly   464 QHGDSSSPSSSC------TSSTPSSPALFQQRERELDQAGSSSSANLLPTPSLG--------KHQ 514

  Fly    64 P----------LHNGGWIGNGL----------PPAPVTRTISSDRLV------------------ 90
            |          ..:||..|..|          |.||.|.....|.||                  
  Fly   515 PSQFNFPNVTVTSSGGSGGVSLISNEPVPEQFPTAPATANGGLDSLVSSSNGHMSSLIGSQTSNA 579

  Fly    91 ---------------TGSSC----RALRTA--------------------------VSALYSVDD 110
                           |.|:|    |.|.||                          :|...|.|.
  Fly   580 STAATLTGSLVNSTTTTSTCSFFPRKLSTAGVDKRTPFTSEYTDTHKSNDSDKTVSLSGSASTDS 644

  Fly   111 -----------------------------------FVKEKIGSGFFSEVYKVTHRTTGQVMVLKM 140
                                               .:.|:||.|.|..|::....  |.|.|..:
  Fly   645 DRTPVRVDSTEDGDSGQWRQNSISLKEWDIPYGDLLLLERIGQGRFGTVHRALWH--GDVAVKLL 707

  Fly   141 NQLRANRPNMLR----EVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVL 201
            |:......:||.    ||.......|.|::.|||.|:....|..:|....|.:|...:..:....
  Fly   708 NEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGACMNPPYLAIVTSLCKGNTLYTYIHQRREKF 772

  Fly   202 SATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAKIPVKSRKSR 266
            :..:.:.:|..||:||.|:|...|.|:||.:||:.|.|     .:.::.||||.:...:......
  Fly   773 AMNRTLLIAQQIAQGMGYLHAREIIHKDLRTKNIFIEN-----GKVIITDFGLFSSTKLLYCDMG 832

  Fly   267 LETVGSPY-W-----------VSPECLKGQWYDQT--SDVFSFGIIQCEIIARIEADPDMMPRTA 317
            |   |.|: |           :.||..:|:..:.|  |||:|||.:..|:|.......|....:.
  Fly   833 L---GVPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELICGEFTFKDQPAESI 894

  Fly   318 SFGLDYLAFVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLE 368
            .:.:.......|..:.:......|...|..|:.:.||.|    .:|..|||
  Fly   895 IWQVGRGMKQSLANLQSGRDVKDLLMLCWTYEKEHRPQF----ARLLSLLE 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 67/267 (25%)
PKc_like 116..370 CDD:304357 70/271 (26%)
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 71/278 (26%)
Pkinase_Tyr 679..940 CDD:285015 68/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.