DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and LIMK2

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_001026971.1 Gene:LIMK2 / 3985 HGNCID:6614 Length:686 Species:Homo sapiens


Alignment Length:342 Identity:126/342 - (36%)
Similarity:179/342 - (52%) Gaps:35/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AGMCTTATTVTTSTNGDATAEAPVKHQPLHNGGWIGNGL-PPAPVTRTISSDRLVTGSSCRALRT 100
            ||.....:|:.|..|    .|..::.:.|.....|.... |.:|....:.|..:....|.|...:
Human   239 AGHPHALSTLDTKEN----LEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSS 299

  Fly   101 AVSALYSVDDFVK-EKIGSGFFSEVYKVTHRTTGQVMVLKMNQLRAN---RPNMLREVQLLNKLS 161
            ....::...|.:. |.:|.|||.:..||||:.||:|||:| ..:|.:   :...|.||:::..|.
Human   300 YSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK-ELIRCDEETQKTFLTEVKVMRSLD 363

  Fly   162 HANILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIF 226
            |.|:|.|:||..::.:|:.|||||.||:|:..|.:.: .....||:|.|.|||.||:|:|...|.
Human   364 HPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMD-PFPWQQKVRFAKGIASGMAYLHSMCII 427

  Fly   227 HRDLTSKNVLIRNLANDQYEAVVGDFGLAAKI-------PVK------------SRKSRLETVGS 272
            ||||.|.|.||:.    ....||.||||:..|       |::            .||.|...||:
Human   428 HRDLNSHNCLIKL----DKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGN 488

  Fly   273 PYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAFVE-LCPMDTPP 336
            |||::||.|.|:.||:|.|:|||||:.||||.::.||||.:|||..|||:...|.| ..|.|.||
Human   489 PYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPP 553

  Fly   337 VFLRLAFYCCLYDAKSR 353
            .|..||..||..:.:||
Human   554 AFFPLAAICCRLEPESR 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 112/265 (42%)
PKc_like 116..370 CDD:304357 111/261 (43%)
LIMK2NP_001026971.1 LIM <15..44 CDD:295319
LIM2_LIMK2 46..104 CDD:188849
PDZ 131..215 CDD:278991
PKc_like 316..570 CDD:328722 109/259 (42%)
PP1_inhibitor 564..686 CDD:283108 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.