DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdi and Raf

DIOPT Version :9

Sequence 1:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster


Alignment Length:429 Identity:118/429 - (27%)
Similarity:177/429 - (41%) Gaps:71/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLNQHSGPGPPSEICG-------LSVDQVDSSAASPFIWPSTAGMC-TTATTVTTSTNGDATAEA 58
            |....|...|||...|       ..:.|.|.|.::|       .:| ....:||:........:|
  Fly   313 SSGSSSSSKPPSSSSGNHRQGRPPRISQDDRSNSAP-------NVCINNIRSVTSEVQRSLIMQA 370

  Fly    59 --PVKHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRA-----LRTAVSA-----LYSVDDF 111
              |:.|....:    .|....:| |.|:..:|....|:..:     ||.|.|:     :.:.:..
  Fly   371 RPPLPHPCTDH----SNSTQASP-TSTLKHNRPRARSADESNKNLLLRDAKSSEENWNILAEEIL 430

  Fly   112 VKEKIGSGFFSEVYKVTHRTTGQVMVLKMN-------QLRANRPNMLREVQLLNKLSHANILSFM 169
            :..:||||.|..||:.  ...|.|.|..:|       ||:|.:    .||.:|.|..|.|||.||
  Fly   431 IGPRIGSGSFGTVYRA--HWHGPVAVKTLNVKTPSPAQLQAFK----NEVAMLKKTRHCNILLFM 489

  Fly   170 GVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKN 234
            | ||.:..|..:|::..|.||.:.:...|........|.:...:|:||.|:|...|.||||.|.|
  Fly   490 G-CVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNN 553

  Fly   235 VLIRNLANDQYEAVVGDFGLA-AKIPVKSRKSRLETVGSPYWVSPECLKGQW---YDQTSDVFSF 295
            :.:    ::.....:|||||| ||......|...:..||..|::||.::.|.   |...|||::|
  Fly   554 IFL----HEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAF 614

  Fly   296 GIIQCEIIARIEADPDMMPRTASFGLDYLAFVE----LCP------MDTPPVFLRLAFYCCLYDA 350
            ||:..|::|      :.:|.......|.:.|:.    |.|      .|.|....|||..|..|..
  Fly   615 GIVMYELLA------ECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTP 673

  Fly   351 KSRPTFHDATKKLTLLLEKYEHESSAGASP-LSSLELIN 388
            |.||.|......|..:|........:.:.| |:..:|.|
  Fly   674 KDRPLFRPLLNMLENMLRTLPKIHRSASEPNLTQSQLQN 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 86/270 (32%)
PKc_like 116..370 CDD:304357 88/274 (32%)
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 86/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.