DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6026 and Cngb3

DIOPT Version :10

Sequence 1:NP_650778.2 Gene:CG6026 / 42287 FlyBaseID:FBgn0038676 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_038955.1 Gene:Cngb3 / 30952 MGIID:1353562 Length:694 Species:Mus musculus


Alignment Length:212 Identity:49/212 - (23%)
Similarity:69/212 - (32%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PVKYSSSKFVYPLVSSSYANLKYQGSNKNYITNKKPTSVVAPVTPPPPNYHSSNFFTVPTTKLTA 185
            |::....|.:.|.:||.......||.|:   :.|:|.....|:|  ....||....:.....|..
Mouse    14 PMEGRMEKKLCPNLSSLSQPTIAQGDNQ---SEKEPLRSRTPIT--FEKSHSKEDNSTGENSLRD 73

  Fly   186 VTPTAGAYYPSSPSTSTSTTTSTSTTTTTTTTTRGTLPPSRKPVTTTTTTAPTSPAAKYTTTSRR 250
            .||.     |.....:..|.|......|.|...|        ||:..|....||...:||.....
Mouse    74 FTPN-----PDPECRAELTRTMAEMEKTRTGKER--------PVSFKTKVLETSIINEYTDAHLH 125

  Fly   251 PIPLQTVSTTPQPPRTSTTRKKFVPTKKYSPTVPSTSGRP-------------TVGHEDQR-PVK 301
            .:..:....|....:|.|..:.|...:..|.|..||:..|             |...:.|| |||
Mouse   126 NLVERMRERTALYKKTLTEEENFPEVEASSQTAMSTNISPKQENNSKLKEHQDTFSFKPQRVPVK 190

  Fly   302 SS------PRPTPSSSD 312
            ..      ||...|.:|
Mouse   191 EHLRRMILPRSIDSYTD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6026NP_650778.2 PHA03378 <792..975 CDD:223065
Cngb3NP_038955.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..82 16/67 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..177 6/30 (20%)
PLN03192 202..>588 CDD:215625 2/6 (33%)
Ion conduction pathway. /evidence=ECO:0000250|UniProtKB:Q9NQW8 340..439
Selectivity filter. /evidence=ECO:0000250|UniProtKB:Q9NQW8 399..402
C-linker. /evidence=ECO:0000250|UniProtKB:Q9NQW8 442..518
Cyclic nucleotide-binding domain. /evidence=ECO:0000250|UniProtKB:Q9NQW8 522..638
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.