DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6026 and CNGA3

DIOPT Version :10

Sequence 1:NP_650778.2 Gene:CG6026 / 42287 FlyBaseID:FBgn0038676 Length:1555 Species:Drosophila melanogaster
Sequence 2:XP_011508856.1 Gene:CNGA3 / 1261 HGNCID:2150 Length:749 Species:Homo sapiens


Alignment Length:99 Identity:25/99 - (25%)
Similarity:43/99 - (43%) Gaps:24/99 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1008 GPGGDVNRRVYRLPPYGGQNVPYM---PDHMYPRRPQGAGPLRSVDGY------------PAERH 1057
            ||.|.::|.::.|..:..::|.:.   || .:|.|.:|| .|:.|...            ||:| 
Human   123 GPQGRLSRLIFLLRRWAARHVHHQDQGPD-SFPDRFRGA-ELKEVSSQESNAQANVGSQEPADR- 184

  Fly  1058 APSSEPYKTIDAEAAADFEEE------DLVINDP 1085
            ..|:.|....:...:.:.|||      |.::.||
Human   185 GRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6026NP_650778.2 PHA03378 <792..975 CDD:223065
CNGA3XP_011508856.1 Ion_trans 223..465 CDD:459842
CAP_ED 537..653 CDD:237999
CLZ 653..722 CDD:465160
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.