DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6026 and HCN4

DIOPT Version :10

Sequence 1:NP_650778.2 Gene:CG6026 / 42287 FlyBaseID:FBgn0038676 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_005468.1 Gene:HCN4 / 10021 HGNCID:16882 Length:1203 Species:Homo sapiens


Alignment Length:53 Identity:13/53 - (24%)
Similarity:25/53 - (47%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALFNE-------SLRKVNEQQPPTIIEEDE--TPKRANRPPDLQGFSILDE 44
            :||.:.:       :||...|.....:::..|  :|:...|||.|: ..|:|:
Human   330 LAAAYEQDLLPGGCTLRITVEDSDKHLLKSPELPSPQAEKRPPTLR-LEIIDK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6026NP_650778.2 PHA03378 <792..975 CDD:223065
HCN4NP_005468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..182
Involved in subunit assembly. /evidence=ECO:0000250 209..260
Ion_trans_N 218..260 CDD:400630
PLN03192 253..>740 CDD:215625 13/53 (25%)
CAP_ED 595..703 CDD:237999
PHA03247 <766..1044 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 836..856
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 870..897
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1203
PHA03247 <928..1200 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.