DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6013 and ccdc124

DIOPT Version :9

Sequence 1:NP_650777.1 Gene:CG6013 / 42286 FlyBaseID:FBgn0038675 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001016496.1 Gene:ccdc124 / 549250 XenbaseID:XB-GENE-1015198 Length:217 Species:Xenopus tropicalis


Alignment Length:216 Identity:95/216 - (43%)
Similarity:141/216 - (65%) Gaps:12/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKK-MGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQRKDEEERKRAEAAK 64
            |||| .|.|:|:..||.||...|.....|:.||.||..|:||||::.:|.|||:::|:||.|..:
 Frog     1 MPKKFQGENTKSAVARARKAEAKAVADAKRQKEIEDAYWQDDDKHVMRKGQRKEDKEKKRLEQLE 65

  Fly    65 RKAEAKALLDQEMSSINTQRKQPLA--KINRQMILEEMEKKQRVIEAINEANKPMAARVVVQNHI 127
            ||.|::.||::|.|.:..:..:|.|  |:.|..|.|.:.:::.. :||:|  ||   :..::..:
 Frog    66 RKKESQRLLEEEDSKMKGKPIKPAAPSKVTRAQIEETLHREEEE-KAISE--KP---KTHLEIPL 124

  Fly   128 EENLNRSMADTD--VASNIDEAIVVLSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLRM 190
            ||||||.:.:..  .|..:::||..||:: .|.|:|||:||:||:..||..|:||||.|||::|:
 Frog   125 EENLNRRILEEGEVEARTVEDAIAALSMS-KELDRHPERRMKAAFTAFEEINMPRIKQENPNMRL 188

  Fly   191 SQWKQLLMKEWNKSPDNPFNQ 211
            ||.||||.|||.|||:||.||
 Frog   189 SQLKQLLKKEWMKSPENPMNQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6013NP_650777.1 DUF1014 93..211 CDD:283823 53/119 (45%)
ccdc124NP_001016496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95 40/93 (43%)
Ccdc124 95..207 CDD:368814 52/118 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7269
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41702
Inparanoid 1 1.050 164 1.000 Inparanoid score I4073
OMA 1 1.010 - - QHG54132
OrthoDB 1 1.010 - - D1585903at2759
OrthoFinder 1 1.000 - - FOG0005563
OrthoInspector 1 1.000 - - oto104257
Panther 1 1.100 - - LDO PTHR21680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R173
SonicParanoid 1 1.000 - - X3982
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.