DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6013 and Ccdc124

DIOPT Version :9

Sequence 1:NP_650777.1 Gene:CG6013 / 42286 FlyBaseID:FBgn0038675 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_081240.1 Gene:Ccdc124 / 234388 MGIID:1916403 Length:217 Species:Mus musculus


Alignment Length:217 Identity:97/217 - (44%)
Similarity:139/217 - (64%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKK-MGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQRKDEEERKRAEAAK 64
            |||| .|.|||:..||.|:...|.|...||.||.||..|:|:||::.:|:|||:|:|::|.|..:
Mouse     1 MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLE 65

  Fly    65 RKAEAKALLDQEMSSI---NTQRKQPLAKINRQMILEEMEKKQRVIEAINEANKPMAARVVVQNH 126
            ||.|.:.||::|.|.:   ...|..| ||:.|..|.:.:.::||. |.:.:|...:      :..
Mouse    66 RKKETQRLLEEEDSRLKGGKAPRVAP-AKVTRAQIEDSLRREQRA-EPVEKAKSHL------ELP 122

  Fly   127 IEENLNRSMAD--TDVASNIDEAIVVLSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLR 189
            :||||||.:.:  :..|..:::||.||||.: |.|:|||:|||||:..||...|||:|.|||::|
Mouse   123 LEENLNRRLQEEGSVEARTVEDAIAVLSVAE-EADRHPERRMRAAFTAFEEVQLPRLKQENPNMR 186

  Fly   190 MSQWKQLLMKEWNKSPDNPFNQ 211
            :||.||||.|||.:|||||.||
Mouse   187 LSQLKQLLKKEWLRSPDNPMNQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6013NP_650777.1 DUF1014 93..211 CDD:283823 53/119 (45%)
Ccdc124NP_081240.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..120 48/126 (38%)
Ccdc124 95..206 CDD:399330 52/118 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838184
Domainoid 1 1.000 103 1.000 Domainoid score I6781
eggNOG 1 0.900 - - E1_KOG3223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41702
Inparanoid 1 1.050 170 1.000 Inparanoid score I4127
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54132
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005563
OrthoInspector 1 1.000 - - oto94035
orthoMCL 1 0.900 - - OOG6_102871
Panther 1 1.100 - - LDO PTHR21680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R173
SonicParanoid 1 1.000 - - X3982
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.