powered by:
Protein Alignment CG6013 and LSO1
DIOPT Version :9
Sequence 1: | NP_650777.1 |
Gene: | CG6013 / 42286 |
FlyBaseID: | FBgn0038675 |
Length: | 213 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_878106.1 |
Gene: | LSO1 / 1466469 |
SGDID: | S000028523 |
Length: | 93 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 37/71 - (52%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 AVEARERKEATKKATQEKKSKEAED-RLWRDDDKNLAKKQQRKDEEERKRAEAAKRKAEAKALLD 74
|..||:|::|.:|...||:..||:: :.|.:..:. ..|:|...|:|:.|..:.|.|...||.
Yeast 17 AGRARKRRQAYEKDQLEKQQLEAQEAQRWEEGART---PNQKKLIMEQKKTEKLRAKKERDQLLA 78
Fly 75 QEMSSI 80
.|..::
Yeast 79 AEEEAL 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6013 | NP_650777.1 |
DUF1014 |
93..211 |
CDD:283823 |
|
LSO1 | NP_878106.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3223 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.