DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6013 and LSO1

DIOPT Version :9

Sequence 1:NP_650777.1 Gene:CG6013 / 42286 FlyBaseID:FBgn0038675 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_878106.1 Gene:LSO1 / 1466469 SGDID:S000028523 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:21/71 - (29%)
Similarity:37/71 - (52%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVEARERKEATKKATQEKKSKEAED-RLWRDDDKNLAKKQQRKDEEERKRAEAAKRKAEAKALLD 74
            |..||:|::|.:|...||:..||:: :.|.:..:.   ..|:|...|:|:.|..:.|.|...||.
Yeast    17 AGRARKRRQAYEKDQLEKQQLEAQEAQRWEEGART---PNQKKLIMEQKKTEKLRAKKERDQLLA 78

  Fly    75 QEMSSI 80
            .|..::
Yeast    79 AEEEAL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6013NP_650777.1 DUF1014 93..211 CDD:283823
LSO1NP_878106.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.