DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp18 and Prpf18

DIOPT Version :9

Sequence 1:NP_650776.1 Gene:Prp18 / 42285 FlyBaseID:FBgn0027784 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038951256.1 Gene:Prpf18 / 171552 RGDID:708550 Length:361 Species:Rattus norvegicus


Alignment Length:326 Identity:154/326 - (47%)
Similarity:212/326 - (65%) Gaps:17/326 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILKAEIARKRKLLEQRQLVDEKKKYFRRGDLNAKNTEEVLQKVGYIKQESVEAQGQ------- 58
            |||||:||.|||:|:|.|.|:.|.||||:|.:|..|..|...::.|| |..|.:..|:       
  Rat     1 MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGY-KPISEKPSGEVQPKEDD 64

  Fly    59 ----TTEGAYSFVADGQNILP----RTEVIRRLRERGEPILIFGETEPEAFDRLRQCEISQPEAN 115
                |:......:...:..||    |.||||||||||||:.:||||:.:||.|||:.||..||.|
  Rat    65 QKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPMRLFGETDYDAFQRLRKIEILTPEVN 129

  Fly   116 RGFRNDFQEAMEQVDAAYLQEMFANTPTTKEDKKSDFAELDESVSWESIQTMAANMGRNKDY-DM 179
            :|.|||.:.|::::|..||.|:.......:||.::|....:|:.:.|.::.:..::|:..|: ||
  Rat   130 KGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDM 194

  Fly   180 DVIITLLTFLLKLWNDQIANYSKHEKMSTKVKMTRVIYTQTKEYVKPLFRKLKHHTLPEDILDSL 244
            |:|...|.|||.:|..::.:...:.|.|.:.|:......||:.|::||||||:...||.||.:|:
  Rat   195 DIITKFLKFLLGVWAKELNSREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESI 259

  Fly   245 RDICKHLLNRNYITASDAYLEMAIGNAPWPIGVTMVGIHARTGREKIFSKNVAHVMNDETQRKYI 309
            .||.|.:|.|.|:.|:||||:|||||||||||||||||||||||||||||:||||:|||||||||
  Rat   260 TDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYI 324

  Fly   310 Q 310
            |
  Rat   325 Q 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp18NP_650776.1 SFM 74..117 CDD:128776 29/46 (63%)
Prp18 186..322 CDD:280929 76/125 (61%)
Prpf18XP_038951256.1 SFM 88..131 CDD:128776 27/42 (64%)
Prp18 200..325 CDD:397123 74/124 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346083
Domainoid 1 1.000 185 1.000 Domainoid score I3300
eggNOG 1 0.900 - - E1_KOG2808
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2726
Inparanoid 1 1.050 338 1.000 Inparanoid score I2306
OMA 1 1.010 - - QHG54709
OrthoDB 1 1.010 - - D1485522at2759
OrthoFinder 1 1.000 - - FOG0004368
OrthoInspector 1 1.000 - - oto97478
orthoMCL 1 0.900 - - OOG6_102077
Panther 1 1.100 - - LDO PTHR13007
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3091
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.