DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Noxred1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_082020.1 Gene:Noxred1 / 71275 MGIID:1918525 Length:366 Species:Mus musculus


Alignment Length:180 Identity:37/180 - (20%)
Similarity:69/180 - (38%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFIC 72
            :|.||.|::...:.:.|::...:.|..:|:|....|:|...|.||.....||..|...:.::|:|
Mouse    81 VGIIGCGHLGKQLTNVLLKTVPIPAENLQISTRRPESLGELRKLGVRCVYDNAAVASWAKVLFLC 145

  Fly    73 VKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSMQV 137
            ..|..|.....:::.|                    |......:||:.:..|..::::.|     
Mouse   146 CLPAQLPNICLEIQSK--------------------LNKHCTVYSFVSAIPLPRLKSLLN----- 185

  Fly   138 GEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGP 187
                  :|...|..:...|...   |..|..::||.::.| .|.:.|..|
Mouse   186 ------HTNILRPQYQFAEDYD---NIWGENEEVPIALQD-TTIIRGTCP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 37/180 (21%)
F420_oxidored 9..106 CDD:281759 21/96 (22%)
P5CR_dimer 172..276 CDD:291418 5/16 (31%)
Noxred1NP_082020.1 NADB_Rossmann 82..160 CDD:304358 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.