DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Pycr2

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_598466.1 Gene:Pycr2 / 69051 MGIID:1277956 Length:320 Species:Mus musculus


Alignment Length:277 Identity:110/277 - (39%)
Similarity:163/277 - (58%) Gaps:18/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIE--NLQRWRDLGAVTCDDNCMVLEHSDIVF 70
            :||||.|.:|.|:..|....|::.|.::..|.|.::  .:...|.:|......|...:.|||::|
Mouse     3 VGFIGAGQLACALARGFTAAGVLSAHKIIASSPDMDLPTVSALRRMGVNLTRSNKDTVRHSDVLF 67

  Fly    71 ICVKPH----MLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLE-EAFSFMGSSELKVIRTM 130
            :.||||    :|....|.::.:|:         |||..||.::.::| :..:|..:.  ||||.|
Mouse    68 LAVKPHIIPFILDEIGADVQERHI---------VVSCAAGVTISSVEKKLMAFQPAP--KVIRCM 121

  Fly   131 PNTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIE 195
            .||.:.|.||.|||.........|.:.:..:::::|...:|.|.:|||:||::|.|||:.:..::
Mouse   122 TNTPVVVREGATVYATGTHALVEDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAYAFMALD 186

  Fly   196 ALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLR 260
            ||||||||.||||::|::..||.||||||.:|.:..||..|:|.|||||||||..:|.||.|..|
Mouse   187 ALADGGVKMGVPRRLAVRLGAQALLGAAKMLLDSEDHPGQLKDNVCSPGGATIHALHFLESGGFR 251

  Fly   261 STLINAVEKSSQRSAEL 277
            |.||||||.|..|:.||
Mouse   252 SLLINAVEASCIRTREL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 110/277 (40%)
F420_oxidored 9..106 CDD:281759 29/102 (28%)
P5CR_dimer 172..276 CDD:291418 59/103 (57%)
Pycr2NP_598466.1 PLN02688 1..268 CDD:178291 108/275 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5304
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.