DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Noxred1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006240463.1 Gene:Noxred1 / 681924 RGDID:1589353 Length:367 Species:Rattus norvegicus


Alignment Length:215 Identity:44/215 - (20%)
Similarity:83/215 - (38%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEK--IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSD 67
            |||  :|.||.|::...:.:.|::...:....:|:|....::|...|.||.....||..|...:.
  Rat    76 DEKLTVGVIGCGHIGRQLTNVLLKTVSIPPENLQISTRRPDSLVELRKLGVRCVYDNAAVANWAK 140

  Fly    68 IVFICVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPN 132
            ::|:|..|..|.....:::          |||..|.:          .:||:.:..:..::|:.|
  Rat   141 VLFLCCLPAQLPNICLEIQ----------SKLDKSCI----------VYSFVSAITIPRLKTLLN 185

  Fly   133 TSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGP---------- 187
                       :|...|..:..:||..   |..|..::||.::.:: :.:.|..|          
  Rat   186 -----------HTNIVRPQYQFVEKFE---NIWGENEEVPAALRNS-SIIRGTCPYNSLGGVILN 235

  Fly   188 -----AFVYTIIEALADGGV 202
                 ...|.:|.|....||
  Rat   236 VKWLEGLCYALINACTSRGV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 43/214 (20%)
F420_oxidored 9..106 CDD:281759 22/96 (23%)
P5CR_dimer 172..276 CDD:291418 8/46 (17%)
Noxred1XP_006240463.1 NADB_Rossmann 82..160 CDD:304358 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.