DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Pycrl

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_079688.2 Gene:Pycrl / 66194 MGIID:1913444 Length:274 Species:Mus musculus


Alignment Length:274 Identity:111/274 - (40%)
Similarity:151/274 - (55%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFI 71
            ::||:|.|.||.||..||::.|.|:|.||..|.|...||..:|.||..|...|..||::..:|..
Mouse    10 RVGFVGAGRMAEAIARGLIQAGKVEAKQVLASAPTDNNLCHFRALGCQTTHSNHEVLQNCPLVIF 74

  Fly    72 CVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSMQ 136
            ..||.:|....|:     |........::|||.||.||.|:|...    ....:|:|..||....
Mouse    75 ATKPQVLPTVLAE-----VAPIVTTEHIIVSVAAGISLSTMEGLL----PPNTRVLRVSPNLPCV 130

  Fly   137 VGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALADGG 201
            |.||..|........:.|.|.:..:|.|.|...:||||.:|..||::|.|.|||.|..||||:|.
Mouse   131 VQEGAMVMARGHHAGNDDAELLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFVCTFSEALAEGA 195

  Fly   202 VKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRSTLINA 266
            :|.|:|..:|.:.|||||||.||.:...|||||.||.:|.:|.|.||.|:|.||:|..|:..::|
Mouse   196 IKMGMPSGLAHRIAAQTLLGTAKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALERGGFRAATMSA 260

  Fly   267 VEKSSQRSAELGKK 280
            ||.::.|:.||.||
Mouse   261 VEAATCRAKELSKK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 109/272 (40%)
F420_oxidored 9..106 CDD:281759 35/96 (36%)
P5CR_dimer 172..276 CDD:291418 52/103 (50%)
PycrlNP_079688.2 PLN02688 10..273 CDD:178291 109/271 (40%)
F420_oxidored 12..104 CDD:281759 35/96 (36%)
P5CR_dimer 166..270 CDD:291418 52/103 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1487
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.