DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and PYCR1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001269210.1 Gene:PYCR1 / 5831 HGNCID:9721 Length:346 Species:Homo sapiens


Alignment Length:276 Identity:110/276 - (39%)
Similarity:164/276 - (59%) Gaps:16/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIE--NLQRWRDLGAVTCDDNCMVLEHSDIVF 70
            :||||.|.:|:|:..|....|::.|.::..|.|.::  .:...|.:|......|...::|||::|
Human    30 VGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLF 94

  Fly    71 ICVKPH----MLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMP 131
            :.||||    :|....|.::.:|:         |||..||.::.::|:..|....:. :|||.|.
Human    95 LAVKPHIIPFILDEIGADIEDRHI---------VVSCAAGVTISSIEKKLSAFRPAP-RVIRCMT 149

  Fly   132 NTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEA 196
            ||.:.|.||.|||.........|...:..:|:::|...:|.|.:||||||::|.|||:.:|.::|
Human   150 NTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDA 214

  Fly   197 LADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRS 261
            |||||||.|:||::|::..||.||||||.:|.:.:||..|:|.|.|||||||..:|.||.|..||
Human   215 LADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRS 279

  Fly   262 TLINAVEKSSQRSAEL 277
            .||||||.|..|:.||
Human   280 LLINAVEASCIRTREL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 110/276 (40%)
F420_oxidored 9..106 CDD:281759 29/102 (28%)
P5CR_dimer 172..276 CDD:291418 59/103 (57%)
PYCR1NP_001269210.1 P5CR_dimer 28..295 CDD:330785 108/274 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5424
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56002
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.