DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and pycr3

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001038403.1 Gene:pycr3 / 560682 ZFINID:ZDB-GENE-041014-244 Length:288 Species:Danio rerio


Alignment Length:276 Identity:109/276 - (39%)
Similarity:160/276 - (57%) Gaps:13/276 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFI 71
            ||||||.||||:.:..|::..|.|..|.:.:|.|.:.||.|:::.|......|..|:..|.::|:
Zfish    20 KIGFIGAGNMAFGVAQGIIASGKVPPSNIIISAPSMNNLPRFKEKGVSVTHSNHEVVGGSRLIFL 84

  Fly    72 CVKPHMLTPCAAQLKYKHVPSAKDASK--LVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTS 134
            .||||::.....::       :::.:|  ::||:.||.::.||||..    .:...|||.|||..
Zfish    85 AVKPHIIPQVLKEI-------SQEVTKEHIIVSMAAGITIATLEELL----PAGTHVIRIMPNLP 138

  Fly   135 MQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALAD 199
            ..:.||..:.:..:.....:...:..:|...||.:..|||.|||..|::|.|.||||...|||||
Zfish   139 CMLLEGALLLSCGSHAGEQEETLLKTLLGPCGLVEFGPESWIDAHVGLSGSGVAFVYVFAEALAD 203

  Fly   200 GGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRSTLI 264
            |.||.|:|..:|.:.||||:|||...:..:||.||.|:.|||:|||.||.|:|.||||..|:..|
Zfish   204 GAVKMGMPSTLARRIAAQTILGAGVLLRDSGKLPAELKAEVCTPGGTTIHGIHALEKGGFRAAAI 268

  Fly   265 NAVEKSSQRSAELGKK 280
            .|||.:|:|:.|||.|
Zfish   269 GAVEAASERARELGNK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 108/274 (39%)
F420_oxidored 9..106 CDD:281759 29/98 (30%)
P5CR_dimer 172..276 CDD:291418 57/103 (55%)
pycr3NP_001038403.1 PLN02688 20..283 CDD:178291 107/273 (39%)
F420_oxidored 22..114 CDD:281759 29/98 (30%)
P5CR_dimer 176..280 CDD:291418 57/103 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10077
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.