DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and P5cr-2

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:99/277 - (35%)
Similarity:160/277 - (57%) Gaps:14/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIE---NLQRWRDLGAVTCDDNCMVLEHSDI 68
            ||||:||||||.|:..|.:..|:.|.:.: ::..|..   :||.::.||..|...|..|::.||:
  Fly     6 KIGFLGGGNMAKALAKGFLAAGLAKPNTL-IASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDV 69

  Fly    69 VFICVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNT 133
            ||:.|||.::....::::      ...:.||.:||..|.:|.|:|.:.    |.:.:|||.|||.
  Fly    70 VFVSVKPQVVPSVLSEIQ------PLSSGKLFLSVAMGITLSTIESSL----SPQARVIRVMPNL 124

  Fly   134 SMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALA 198
            ...|..||:|:...::.:..|.:....:|.::|..:.|.||.:|.||.::|.|||:|:.:|||||
  Fly   125 PAVVCSGCSVFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALA 189

  Fly   199 DGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRSTL 263
            ||.|..|:||.:|.:.|:||:|||...|..:|.||..|:|.|.||.|:|...:.:||....|:.:
  Fly   190 DGAVHMGMPRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAV 254

  Fly   264 INAVEKSSQRSAELGKK 280
            ..|||:::.|..::..|
  Fly   255 SGAVEQATLRCRQISGK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 98/275 (36%)
F420_oxidored 9..106 CDD:281759 31/99 (31%)
P5CR_dimer 172..276 CDD:291418 46/103 (45%)
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 98/274 (36%)
F420_oxidored 8..101 CDD:281759 31/99 (31%)
P5CR_dimer 163..267 CDD:291418 46/103 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450242
Domainoid 1 1.000 90 1.000 Domainoid score I1773
eggNOG 1 0.900 - - E1_COG0345
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1310
Isobase 1 0.950 - 0 Normalized mean entropy S1487
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109172at33392
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - otm46782
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - P PTHR11645
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
1211.750

Return to query results.
Submit another query.