DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and pycr1a

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_957120.1 Gene:pycr1a / 393799 ZFINID:ZDB-GENE-040426-1675 Length:320 Species:Danio rerio


Alignment Length:272 Identity:107/272 - (39%)
Similarity:160/272 - (58%) Gaps:8/272 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGP--HIENLQRWRDLGAVTCDDNCMVLEHSDIVF 70
            :||||.|.:|:|:..|....|::...::..|.|  .:..:...|.:||.....|...:..||::|
Zfish     3 VGFIGAGQLAHALVKGFTAAGVIATHRITASSPDTDLPTVIGLRKMGAFFTTSNKETVSKSDVLF 67

  Fly    71 ICVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSM 135
            :.||||::.....::.    |..:| ..|:||..||.::.::|:.. ....|..||||.|.||.:
Zfish    68 LAVKPHIIPFVLDEIG----PDIED-RHLIVSCAAGVTISSIEKKL-LQYRSAPKVIRCMTNTPV 126

  Fly   136 QVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALADG 200
            .|.||.|||.........|.:.:..::.::|...:|.|.:||||||::|.|||:.:|.::|||||
Zfish   127 VVREGATVYATGTHAEVEDGKLLEQLMASVGYCTEVEEDLIDAVTGLSGSGPAYAFTAVDALADG 191

  Fly   201 GVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRSTLIN 265
            |||.|:||::|::..||.||||||.:|.:.:||..|:|.|.|||||||..:|.:|.|..||.|||
Zfish   192 GVKMGLPRRLAVRLGAQALLGAAKMLLESEQHPGQLKDNVASPGGATIHALHVMESGGFRSLLIN 256

  Fly   266 AVEKSSQRSAEL 277
            |||.|..|:.||
Zfish   257 AVEASCIRTREL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 107/272 (39%)
F420_oxidored 9..106 CDD:281759 27/98 (28%)
P5CR_dimer 172..276 CDD:291418 58/103 (56%)
pycr1aNP_957120.1 PLN02688 1..268 CDD:178291 105/270 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5365
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.