DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Pycr3

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038934748.1 Gene:Pycr3 / 300035 RGDID:1309115 Length:289 Species:Rattus norvegicus


Alignment Length:285 Identity:116/285 - (40%)
Similarity:160/285 - (56%) Gaps:16/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFI 71
            ::||:|.|.||.||..||:|.|.|:|.||..|.|..:||..:|.||..|...|..||::..:|..
  Rat    10 RVGFVGAGRMAEAIAQGLIRAGKVEAKQVLASAPTDKNLCHFRALGCQTTHSNHEVLQNCPLVIF 74

  Fly    72 CVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSF------MGSSEL-----K 125
            ..||.:|....|:     |........::|||.||.||.::|||.|.      :.|.:|     :
  Rat    75 ATKPQVLPAVLAE-----VAPVVTTEHIIVSVAAGISLSSMEEAPSLRLPDTELSSVQLLPPKTR 134

  Fly   126 VIRTMPNTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFV 190
            |:|..||....|.||..|.|......:.|.:.:..:|.|.|...:||||.:|..||::|.|.|||
  Rat   135 VLRVSPNLPCVVQEGAMVMTRGHHAGNEDAKLLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFV 199

  Fly   191 YTIIEALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELE 255
            .|..||||:|.:|.|:|..:|.:.|||||||.||.:...|||||.||.:|.:|.|.||.|:|.||
  Rat   200 CTFSEALAEGAIKMGMPSDLAHRIAAQTLLGTAKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALE 264

  Fly   256 KGNLRSTLINAVEKSSQRSAELGKK 280
            :|..|:..::|||.::.|:.||.||
  Rat   265 QGGFRAAAMSAVEAATCRAKELSKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 114/283 (40%)
F420_oxidored 9..106 CDD:281759 36/96 (38%)
P5CR_dimer 172..276 CDD:291418 52/103 (50%)
Pycr3XP_038934748.1 PLN02688 10..288 CDD:178291 114/282 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.