DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and PYCR2

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_037460.2 Gene:PYCR2 / 29920 HGNCID:30262 Length:320 Species:Homo sapiens


Alignment Length:277 Identity:113/277 - (40%)
Similarity:166/277 - (59%) Gaps:18/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGP--HIENLQRWRDLGAVTCDDNCMVLEHSDIVF 70
            :||||.|.:|||:..|....||:.|.::..|.|  ::..:...|.:|......|...::|||::|
Human     3 VGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLF 67

  Fly    71 ICVKPH----MLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLE-EAFSFMGSSELKVIRTM 130
            :.||||    :|....|.::.:|:         |||..||.::.::| :..:|..:.  ||||.|
Human    68 LAVKPHIIPFILDEIGADVQARHI---------VVSCAAGVTISSVEKKLMAFQPAP--KVIRCM 121

  Fly   131 PNTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIE 195
            .||.:.|.||.|||.........|.:.:..:::::|...:|.|.:||||||::|.|||:.:..::
Human   122 TNTPVVVQEGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALD 186

  Fly   196 ALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLR 260
            ||||||||.|:||::|:|..||.||||||.:|.:.:||..|:|.|||||||||..:|.||.|..|
Human   187 ALADGGVKMGLPRRLAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFR 251

  Fly   261 STLINAVEKSSQRSAEL 277
            |.||||||.|..|:.||
Human   252 SLLINAVEASCIRTREL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 113/277 (41%)
F420_oxidored 9..106 CDD:281759 31/102 (30%)
P5CR_dimer 172..276 CDD:291418 60/103 (58%)
PYCR2NP_037460.2 PLN02688 1..268 CDD:178291 111/275 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5424
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.