DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and SPAPYUG7.05

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_594706.1 Gene:SPAPYUG7.05 / 2543212 PomBaseID:SPAPYUG7.05 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:81/224 - (36%)
Similarity:134/224 - (59%) Gaps:13/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DNCMVLEHSDIVFICVKPHMLTPCAAQLKYKHVPSAKDA--SKLVVSVLAGTSLETLEEAFSFMG 120
            :|..:...|:::.:..||.     ||: ...:.|..|:|  .||::|:|||.::.:|:.    |.
pombe    70 ENAEMAAISNVLLLSCKPQ-----AAE-DVLNSPKMKEALKGKLILSILAGKTISSLQS----ML 124

  Fly   121 SSELKVIRTMPNTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGC 185
            ....:|||.||||:.::.|..:|.......:..|::....:.|.:|.:.::||.:|||.|.|.|.
pombe   125 DESTRVIRIMPNTASRIRESMSVICPGPNATEEDIKFAEWVFNGIGRSMKLPEKLIDAATAVCGS 189

  Fly   186 GPAFVYTIIEALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVG 250
            |||||.|:|||:.||||..|:|...|.:.||||::|..:.| |.|:|||::|::|.:|.|.||.|
pombe   190 GPAFVATMIEAMTDGGVMMGIPFPQAQELAAQTMVGTGRMV-LQGQHPAMIRNDVSTPAGCTISG 253

  Fly   251 VHELEKGNLRSTLINAVEKSSQRSAELGK 279
            :..||.|.:|||:...:|::::.::.|||
pombe   254 LLALEDGKIRSTIARGIEQATKTASGLGK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 81/224 (36%)
F420_oxidored 9..106 CDD:281759 13/49 (27%)
P5CR_dimer 172..276 CDD:291418 49/103 (48%)
SPAPYUG7.05NP_594706.1 ProC 1..282 CDD:223422 79/222 (36%)
F420_oxidored 5..114 CDD:281759 13/49 (27%)
P5CR_dimer 176..275 CDD:291418 49/99 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1794
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1310
OMA 1 1.010 - - QHG60612
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - otm47235
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - LDO PTHR11645
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.