DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and Pycr1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001366015.1 Gene:Pycr1 / 209027 MGIID:2384795 Length:339 Species:Mus musculus


Alignment Length:279 Identity:111/279 - (39%)
Similarity:165/279 - (59%) Gaps:16/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEKIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIE--NLQRWRDLGAVTCDDNCMVLEHSD 67
            |..:||||.|.:|:|:..|....|::.|.::..|.|.::  .:...|.:|......|...:.|||
Mouse    30 DMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDQATVSALRKIGVNLTPHNKETVRHSD 94

  Fly    68 IVFICVKPH----MLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIR 128
            ::|:.||||    :|....|.::.:|:         |||..||.::.::|:..:....:. ||||
Mouse    95 VLFLAVKPHIIPFILDEIGANIEDRHI---------VVSCAAGVTINSIEKKLTAFQPAP-KVIR 149

  Fly   129 TMPNTSMQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTI 193
            .|.||.:.|.||.|||.........|...:..::.::|...:|.|.:||||||::|.|||:.:|.
Mouse   150 CMTNTPVVVREGVTVYATGTHAQVEDGRLVEQLMGSVGFCTEVEEDLIDAVTGLSGSGPAYAFTA 214

  Fly   194 IEALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGN 258
            ::||||||||.|:||::|::..||.||||||.:|.:.:||:.|:|.|||||||||..:|.||.|.
Mouse   215 LDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPSQLKDNVCSPGGATIHALHVLESGG 279

  Fly   259 LRSTLINAVEKSSQRSAEL 277
            .||.||||||.|..|:.||
Mouse   280 FRSLLINAVEASCIRTREL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 110/278 (40%)
F420_oxidored 9..106 CDD:281759 29/102 (28%)
P5CR_dimer 172..276 CDD:291418 60/103 (58%)
Pycr1NP_001366015.1 PLN02688 31..298 CDD:178291 108/276 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5304
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56002
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.