DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and pycr-1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001348640.1 Gene:pycr-1 / 181380 WormBaseID:WBGene00010924 Length:293 Species:Caenorhabditis elegans


Alignment Length:276 Identity:112/276 - (40%)
Similarity:166/276 - (60%) Gaps:11/276 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIEN--LQRWRDLGAVTCDDNCMVLEHSDIV 69
            ||||||.|.||.|:..||:..|.:.|..:..|.|..:.  |.:.:.||..|..||..|::.||:|
 Worm     2 KIGFIGAGKMAQALARGLINSGRITADNIIASSPKRDEVFLDQCKALGLNTTHDNAEVVQKSDVV 66

  Fly    70 FICVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTS 134
            |:.|||..::..|::     :..|.....||||:..|.::..:|...    .::.:|:|.||||.
 Worm    67 FLAVKPVHVSKVASE-----IAPALSKEHLVVSIALGITIRNIESLL----PTKSRVVRVMPNTP 122

  Fly   135 MQVGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALAD 199
            ..|..|.:.:...:.....|.|.:..:|:.:|.|.:|||..||.|||::|.||::::.:||.|||
 Worm   123 SVVRAGASAFAMGSACRDGDAETVEKLLSTVGFAVEVPEIHIDPVTGLSGSGPSYMFAVIEGLAD 187

  Fly   200 GGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVGVHELEKGNLRSTLI 264
            ||||.|:||.:||:.||.|||||||.||.||.|||.|:|:|.||.|:::.|:|:||.|.|:..|:
 Worm   188 GGVKVGLPRDLALKLAAYTLLGAAKMVLETGIHPAQLKDDVQSPAGSSVYGMHKLESGGLKGVLM 252

  Fly   265 NAVEKSSQRSAELGKK 280
            :|||.::.||...|.|
 Worm   253 DAVEAATNRSRATGDK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 111/274 (41%)
F420_oxidored 9..106 CDD:281759 34/98 (35%)
P5CR_dimer 172..276 CDD:291418 58/103 (56%)
pycr-1NP_001348640.1 PLN02688 1..267 CDD:178291 110/273 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I3627
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1487
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.