DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and NOXRED1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001106946.1 Gene:NOXRED1 / 122945 HGNCID:20487 Length:359 Species:Homo sapiens


Alignment Length:251 Identity:47/251 - (18%)
Similarity:84/251 - (33%) Gaps:92/251 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFI 71
            |:|.||||::...:...|::.|.:.|..:::|....|.|...:.||......|..::..:|::|:
Human    78 KVGIIGGGHLGKQLAGTLLQLGPIPAESLRISTRRPETLGELQKLGIKCFYHNADLVSWADVIFL 142

  Fly    72 CVKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSMQ 136
            |..|..|.....::.                    ||||.....:||        :..:|     
Human   143 CCLPSQLPNICVEIY--------------------TSLEKASIVYSF--------VAAIP----- 174

  Fly   137 VGEGCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALADGG 201
                              |.::.|:||...:.:                 |.:.|.         
Human   175 ------------------LPRLKLLLNHTNILR-----------------PQYQYD--------- 195

  Fly   202 VKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVC--SPGGATIVGVHELE 255
             :..|           ::.||.|.|:...:.|.:|: ..|  ||.|..|:.:..||
Human   196 -EDSV-----------SVWGANKGVIAALQDPTILQ-ATCPYSPAGGIILNIKWLE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 47/251 (19%)
F420_oxidored 9..106 CDD:281759 19/96 (20%)
P5CR_dimer 172..276 CDD:291418 16/86 (19%)
NOXRED1NP_001106946.1 F420_oxidored 80..168 CDD:281759 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.