DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr and noxred1

DIOPT Version :9

Sequence 1:NP_524400.2 Gene:P5cr / 42284 FlyBaseID:FBgn0015781 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_005169929.1 Gene:noxred1 / 101884934 ZFINID:ZDB-GENE-130530-573 Length:333 Species:Danio rerio


Alignment Length:105 Identity:28/105 - (26%)
Similarity:51/105 - (48%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRDLGAVTCDDNCMVLEHSDIVFIC 72
            :|.:|||||...:...|:|...:::..:.:|....|.|....::|.....||..:.:.:|::|:|
Zfish    70 VGILGGGNMGKQLAMALIRTSNLRSCDINLSTKRPETLGEISNMGVECYFDNIRLAKWADLLFLC 134

  Fly    73 VKPHMLTPCAAQLKYKHVPSAKDASKLVVSVLAGTSLETL 112
            |.|..|....:.: :.|:||    :.||.|..:...|..|
Zfish   135 VLPSHLPQVCSDI-HCHLPS----NCLVYSFTSAVPLNRL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5crNP_524400.2 ProC 6..280 CDD:223422 28/105 (27%)
F420_oxidored 9..106 CDD:281759 26/96 (27%)
P5CR_dimer 172..276 CDD:291418
noxred1XP_005169929.1 NADB_Rossmann 71..147 CDD:304358 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.