DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14286 and LOC681282

DIOPT Version :9

Sequence 1:NP_650772.1 Gene:CG14286 / 42280 FlyBaseID:FBgn0038673 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_006241984.2 Gene:LOC681282 / 681282 RGDID:1597990 Length:279 Species:Rattus norvegicus


Alignment Length:160 Identity:55/160 - (34%)
Similarity:79/160 - (49%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRRTAKSINKPPPIQGAIK---KPTPVAEPPSIDADLVTQFEVELCWCVQQLQTALDSGKLAQKV 64
            |::..|:.|:.....|..|   .|||...|||.:|. ..|...||.|||:||:..|.:.:...|.
  Rat   121 KQKKKKTPNRVSGTNGKEKPSENPTPDEAPPSAEAQ-AEQLARELAWCVEQLELGLRTQRPTPKQ 184

  Fly    65 AEDTAKNIKVLTSSTAPLIRKRQVMKLALGDYRAKMQQEEQKLLLA------SRQIKFTPTAESS 123
            .|.....|:.|.|...||.||||:|:...|||||:|..|.::.|.|      |.|::....| :.
  Rat   185 KEQAVGAIRTLRSEKTPLPRKRQLMRSLFGDYRAQMDAEWREALRALKAATRSAQVQLVGEA-AR 248

  Fly   124 KKSSFV------KKSALLS--SGKDFRFNF 145
            |||..|      .::..:|  :.::|||||
  Rat   249 KKSGRVCRPRPAGRAGTMSDLTNEEFRFNF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14286NP_650772.1 DUF4615 39..181 CDD:292036 43/121 (36%)
LOC681282XP_006241984.2 DUF4615 159..278 CDD:405972 41/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350481
Domainoid 1 1.000 59 1.000 Domainoid score I10463
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5217
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632971at2759
OrthoFinder 1 1.000 - - FOG0008241
OrthoInspector 1 1.000 - - oto96635
orthoMCL 1 0.900 - - OOG6_108790
Panther 1 1.100 - - LDO PTHR13602
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.