DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14286 and zgc:112185

DIOPT Version :9

Sequence 1:NP_650772.1 Gene:CG14286 / 42280 FlyBaseID:FBgn0038673 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001013472.1 Gene:zgc:112185 / 541326 ZFINID:ZDB-GENE-050320-14 Length:215 Species:Danio rerio


Alignment Length:183 Identity:54/183 - (29%)
Similarity:88/183 - (48%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HKRRTAKSINKPPPIQGAIKKPT--PVAEPPSIDADLVTQFEVELCWCVQQLQTALDSGKLAQKV 64
            ||::..|...:....|....|.|  ..|:..:.:.....|...||.||::||:..|.:.|.:.|.
Zfish    32 HKKKKKKKAGEGKDDQQRETKTTEGETAKQETSELTPDEQLSRELDWCIEQLELGLRTQKTSSKQ 96

  Fly    65 AEDTAKNIKVLTSSTAPLIRKRQVMKLALGDYRAKMQQEEQKLLLASRQIKFTPTAESSKKSSFV 129
            .|:.::.:|.|.||.|||::|||||:...||||.|:::|:      :||.|...:|.:|.:.:.|
Zfish    97 REEASRALKTLRSSKAPLVKKRQVMRAISGDYRKKIEEEK------NRQFKLIQSAMTSARVTTV 155

  Fly   130 KKSALLSSGKDFRFNFPSPAEDTSSKEPQPVQDFDPSSLQPAEAGSPFKFNFT 182
            .:...:...:..|...|....| .|:|.|..|:.:..:  ..|...||.|..|
Zfish   156 SECKPVFHRRAERNTQPKNKTD-GSQETQSSQETNEHT--KTEDTKPFVFTKT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14286NP_650772.1 DUF4615 39..181 CDD:292036 46/141 (33%)
zgc:112185NP_001013472.1 DUF4615 71..213 CDD:292036 47/144 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..111 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..199 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592191
Domainoid 1 1.000 70 1.000 Domainoid score I9540
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5308
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008241
OrthoInspector 1 1.000 - - oto40405
orthoMCL 1 0.900 - - OOG6_108790
Panther 1 1.100 - - LDO PTHR13602
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.