DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14286 and 1110038F14Rik

DIOPT Version :9

Sequence 1:NP_650772.1 Gene:CG14286 / 42280 FlyBaseID:FBgn0038673 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001334469.1 Gene:1110038F14Rik / 117171 MGIID:2152337 Length:222 Species:Mus musculus


Alignment Length:188 Identity:59/188 - (31%)
Similarity:83/188 - (44%) Gaps:39/188 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRRTAKSINKPPPIQGAIK---KPTPVAEPPSIDADLVTQFEVELCWCVQQLQTALDSGKLAQKV 64
            |::..|:.|:.....|:.|   ||.|...|||.:|. ..|...||.|||:||:..|.:.:...|.
Mouse    64 KQKKKKTPNRVSGTNGSEKPSEKPAPDEAPPSAEAQ-AEQLARELAWCVEQLELGLKTQRPTPKQ 127

  Fly    65 AEDTAKNIKVLTSSTAPLIRKRQVMKLALGDYRAKMQQEEQKLLLASRQIKFTPTAESSKKSSFV 129
            .|.....|:.|.|...||.||||:|:...|||||:|..|.::.|.|.:      .|..|.:...|
Mouse   128 KEQAVGAIRTLRSEKTPLPRKRQLMRSLFGDYRAQMDAEWREALRALK------AATHSAQVQLV 186

  Fly   130 KKSALLSSGKDFRFNFPSPAE------DTSSKEPQPVQDFDPSSLQPAEAGSPFKFNF 181
            .::....||:..|   |.|||      |.:|:|                    |:|||
Mouse   187 SEATRKKSGRVCR---PRPAERAKTTPDLTSEE--------------------FRFNF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14286NP_650772.1 DUF4615 39..181 CDD:292036 45/147 (31%)
1110038F14RikNP_001334469.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 12/39 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..210 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846981
Domainoid 1 1.000 61 1.000 Domainoid score I10497
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5277
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008241
OrthoInspector 1 1.000 - - oto93083
orthoMCL 1 0.900 - - OOG6_108790
Panther 1 1.100 - - LDO PTHR13602
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4804
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.880

Return to query results.
Submit another query.