DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and AT4G03120

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_567250.1 Gene:AT4G03120 / 828071 AraportID:AT4G03120 Length:207 Species:Arabidopsis thaliana


Alignment Length:194 Identity:74/194 - (38%)
Similarity:88/194 - (45%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLID-------ATTAAF- 57
            ||:|||||||||||||||||||.|..|.||:.||:.|||::.|:|.|.|||       ..|..: 
plant     1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRIYYQQFEEQQTQSLIDQRIKEHLGQTGGYQ 65

  Fly    58 KAGKITNN--------PFAGGPGGAP--------PKPAGVSIPP----PNMGAPPRPGMPGMPYM 102
            :.|.:.|.        |....||..|        |:|   .:||    |..|.|.....||.|..
plant    66 QVGAVFNQHMLARPRPPMMLPPGSMPMGMRPPVLPRP---MMPPQGYMPPPGVPQMMAPPGAPLP 127

  Fly   103 PPLMNPMM---GMRP-------PPIMNPMAMMG-----------PPPPLGTIPGVRP-GIMNGP 144
            ||..|.::   ||.|       ||.|.|:...|           ||||..|.|...| |..|.|
plant   128 PPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSGNFNNP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 27/36 (75%)
AT4G03120NP_567250.1 zf-U1 1..38 CDD:368798 27/36 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3329
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2098
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003605
OrthoInspector 1 1.000 - - oto3269
orthoMCL 1 0.900 - - OOG6_102948
Panther 1 1.100 - - LDO PTHR31148
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2482
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.