DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and Zmat5

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001343319.1 Gene:Zmat5 / 67178 MGIID:1914428 Length:170 Species:Mus musculus


Alignment Length:165 Identity:35/165 - (21%)
Similarity:52/165 - (31%) Gaps:81/165 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KYYCDYCDTYLTHDSPSVRKTHCTGRKH-----------RD------------------------ 32
            :|:|||||... .|:...||.|..|.:|           ||                        
Mouse     4 RYFCDYCDRSF-QDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCD 67

  Fly    33 ---NVKF----------------------------------YYQKWMEEQAQHLIDATTAAFKAG 60
               |.:|                                  :.:.|:|::|:.|..|.::  :|.
Mouse    68 FGSNCRFSHMSEQDLQELSVQVEEERRAREWPLETAELPEGHLEDWLEKRAKRLSSAPSS--RAE 130

  Fly    61 KITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPG 95
            .|....|. .|.|.||    :...||::.||| ||
Mouse   131 PIRTTVFQ-YPVGWPP----MQELPPSLRAPP-PG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 16/106 (15%)
Zmat5NP_001343319.1 zf-U1 4..>46 CDD:389966 14/42 (33%)
zf-CCCH 55..76 CDD:366217 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.