DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and SNRPC

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_003084.1 Gene:SNRPC / 6631 HGNCID:11157 Length:159 Species:Homo sapiens


Alignment Length:153 Identity:92/153 - (60%)
Similarity:106/153 - (69%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
Human     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSI-PPPNMGAPPRPGMPGMPYM--PPLMNPMMGMRPPPIMNPMAMMGPP 127
            ||:     ||| |||..| |||::..||||||...|:|  ||:| ||||..||.:|         
Human    66 PFS-----APP-PAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMM-PMMGPPPPGMM--------- 114

  Fly   128 PPLGTIPGVRP------GIMNGP 144
             |:|..||:||      .:|.||
Human   115 -PVGPAPGMRPPMGGHMPMMPGP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 31/36 (86%)
SNRPCNP_003084.1 zf-U1 1..38 CDD:368798 31/36 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..96 19/39 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7637
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4110
Isobase 1 0.950 - 0 Normalized mean entropy S740
OMA 1 1.010 - - QHG53368
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003605
OrthoInspector 1 1.000 - - oto90337
orthoMCL 1 0.900 - - OOG6_102948
Panther 1 1.100 - - LDO PTHR31148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1268
SonicParanoid 1 1.000 - - X2482
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.