DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and snrpc

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001016598.1 Gene:snrpc / 549352 XenbaseID:XB-GENE-495092 Length:159 Species:Xenopus tropicalis


Alignment Length:154 Identity:92/154 - (59%)
Similarity:103/154 - (66%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
 Frog     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMPYMPPLMNPMMGMRPPPIMNPMAMMGPPP-- 128
            |||..|.|:...|     |||:||.||||||  || .||:..|.|          |.||||||  
 Frog    66 PFAAPPAGSAMIP-----PPPSMGGPPRPGM--MP-APPMAGPPM----------MPMMGPPPPG 112

  Fly   129 --PLGTIPGVRP------GIMNGP 144
              |:|..||:||      .:|.||
 Frog   113 MMPVGHGPGMRPPMGAHMPMMPGP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 31/36 (86%)
snrpcNP_001016598.1 zf-U1 1..38 CDD:368798 31/36 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..95 19/39 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7207
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3945
OMA 1 1.010 - - QHG53368
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003605
OrthoInspector 1 1.000 - - otm48741
Panther 1 1.100 - - LDO PTHR31148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1268
SonicParanoid 1 1.000 - - X2482
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.